PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G27610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 288aa    MW: 31294.8 Da    PI: 10.4189
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G27610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.63.7e-15208256553
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                      +r+rr++kNRe+A rsRqRK+a++ eLe +v++L++ N++L+k+ ee+ 
  LPERR02G27610.1 208 RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNEDLQKKQEEML 256
                      79***************************************97766543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-13204269IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.254206258IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-10208258No hitNo description
CDDcd147074.25E-24208260No hitNo description
PfamPF001701.2E-13208258IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-14208259No hitNo description
PROSITE patternPS000360211226IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDFPGGSGRQ QQQPQQQQLP PMTPLPLARQ GSVYSLTFDE FQTTLGGVGK DFGSMNMDEL  60
LRSIWTAEES HAVGEPAAVQ RQGSLTLPRT LSQKTDMSVP PAPAPAAVPP PPPPPPPPQQ  120
QPPSVLFGES NVFAPIVPPL SLGNGLVTGG RGGGAAPLLS PVRPVSSNGF GKMEGGDLSS  180
LSPSPVPYVF NGGLRGRKAP GIEKVVERRQ RRMIKNRESA ARSRQRKQAY MMELEAEVAK  240
LKELNEDLQK KQEEMLEQQK NEALERITRQ VGPTTKRICL RRTLTGPW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7796381e-155KP779638.1 Oryza nivara OsbZIP23 (bZIP23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688745.11e-137PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q45e-44AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A0D9VLF80.0A0A0D9VLF8_9ORYZ; Uncharacterized protein
STRINGBRADI1G46060.12e-93(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.22e-26ABRE binding factor 4